TLK2 Antibody - N-terminal region (ARP58343_P050)

• Product Number: ARP58343_P050
• Name: TLK2 Antibody - N-terminal region (ARP58343_P050)
• Protein Size (# AA): 718 amino acids
• Molecular Weight: 79kDa
• NCBI Gene Id: 11011
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Tousled-like kinase 2
• Alias Symbols: HsHPK, MRD57, PKU-ALPHA
• Peptide Sequence: Synthetic peptide located within the following region: SNQSLCSVGSLSDKEVETPEKKQNDQRNRKRKAEPYETSQGKGTPRGHKI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The Tousled-like kinases, first described in Arabidopsis, are nuclear serine/threonine kinases that are potentially involved in the regulation of chromatin assembly.
• Protein Interactions: UBC; RPS6KA1; XPO7; XPO1; ELAVL1; IRF7; IRF4; Dynll1; ASF1B; ASF1A; AURKA; FEZ1; FEZ2; TLK1; TLK2; YWHAZ; MBP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TLK2 (ARP58343_P050) antibody is Catalog # AAP58343 (Previous Catalog # AAPP44708)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TLK2
• Uniprot ID: D3DU07
• Protein Name: Serine/threonine-protein kinase tousled-like 2
• Protein Accession #: NP_001106178
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001112707
• Tested Species Reactivity: Human
• Gene Symbol: TLK2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Image 1: Human Jurkat
  
  WB Suggested Anti-TLK2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysate