VTN Antibody - N-terminal region (ARP58095_P050)

Data Sheet
 
Product Number ARP58095_P050
Product Page www.avivasysbio.com/vtn-antibody-n-terminal-region-arp58095-p050.html
Name VTN Antibody - N-terminal region (ARP58095_P050)
Protein Size (# AA) 478 amino acids
Molecular Weight 52kDa
NCBI Gene Id 7448
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Vitronectin
Alias Symbols VN, V75, VNT
Peptide Sequence Synthetic peptide located within the following region: EDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Upton,Z., (2008) J. Invest. Dermatol. 128 (6), 1535-1544
Description of Target VTN is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond.The protein encoded by this gene is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions GOPC; EED; ADH5; RHOXF1; ADTRP; ETV7; RPL13A; CBX1; PRDX4; CRADD; SIX1; GLUD1; CKS2; CD247; PRKCA; PRKACA; RBM25; WDR18; PRPF40A; SMU1; LUC7L3; SF3B6; HP1BP3; PRPF19; PHGDH; SF3B1; SF3B3; SRSF10; USP39; PRPF8; SF3A1; SAP18; HNRNPR; RBM39; SRSF11; BUD31; D
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-VTN (ARP58095_P050) antibody
Blocking Peptide For anti-VTN (ARP58095_P050) antibody is Catalog # AAP58095 (Previous Catalog # AAPP32528)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human VTN
Uniprot ID P04004
Protein Name Vitronectin
Sample Type Confirmation

VTN is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_000629
Purification Affinity Purified
Nucleotide Accession # NM_000638
Tested Species Reactivity Human
Gene Symbol VTN
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human HepG2
WB Suggested Anti-VTN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysateVTN is supported by BioGPS gene expression data to be expressed in HepG2
Image 2
Human Adult Placenta
Host: Rabbit
Target Name: VTN
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml
Image 3
Human Fetal Lung
Host: Rabbit
Target Name: VTN
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com