| Product Number |
ARP58019_P050 |
| Product Page |
www.avivasysbio.com/hoxb3-antibody-middle-region-arp58019-p050.html |
| Name |
HOXB3 Antibody - middle region (ARP58019_P050) |
| Protein Size (# AA) |
431 amino acids |
| Molecular Weight |
44kDa |
| NCBI Gene Id |
3213 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Homeobox B3 |
| Alias Symbols |
HOX2, HOX2G, Hox-2.7 |
| Peptide Sequence |
Synthetic peptide located within the following region: SGNLDYNGAPPMAPSQHHGPCEPHPTYTDLSSHHAPPPQGRIQEAPKLTH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
HOXB3 belongs to ANTP homeobox family. It is a nuclear protein with a homeobox DNA-binding domain. HOXB3 gene is included in a cluster of homeobox B genes located on chromosome 17. The protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML). |
| Protein Interactions |
CREBBP; EP300; HMGB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HOXB3 (ARP58019_P050) antibody |
| Blocking Peptide |
For anti-HOXB3 (ARP58019_P050) antibody is Catalog # AAP58019 (Previous Catalog # AAPP32442) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HOXB3 |
| Uniprot ID |
P14651 |
| Protein Name |
Homeobox protein Hox-B3 |
| Sample Type Confirmation |
HOXB3 is supported by BioGPS gene expression data to be expressed in NCIH226 |
| Protein Accession # |
NP_002137 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_002146 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HOXB3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 78%; Rat: 100% |
| Image 1 | Human NCI-H226
 | WB Suggested Anti-HOXB3 Antibody Titration: 0.2-1 ug/ml
Positive Control: NCI-H226 cell lysateHOXB3 is supported by BioGPS gene expression data to be expressed in NCIH226 |
|
|
