| Product Number |
ARP57917_P050 |
| Product Page |
www.avivasysbio.com/tcf7l1-antibody-n-terminal-region-arp57917-p050.html |
| Name |
TCF7L1 Antibody - N-terminal region (ARP57917_P050) |
| Protein Size (# AA) |
588 amino acids |
| Molecular Weight |
63kDa |
| NCBI Gene Id |
83439 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Transcription factor 7-like 1 (T-cell specific, HMG-box) |
| Alias Symbols |
TCF3, TCF-3 |
| Peptide Sequence |
Synthetic peptide located within the following region: ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hillier,L.W., (2005) Nature 434 (7034), 724-731 |
| Description of Target |
TCF7L1 participates in the Wnt signaling pathway. It binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. It is necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis. TCF7L1 down-regulates NQO1, leading to increased mitomycin c resistance. |
| Protein Interactions |
UBC; mdfic; Mdfi; DAZAP2; CTNNB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TCF7L1 (ARP57917_P050) antibody |
| Blocking Peptide |
For anti-TCF7L1 (ARP57917_P050) antibody is Catalog # AAP57917 (Previous Catalog # AAPP32328) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TCF7L1 |
| Uniprot ID |
Q9HCS4 |
| Protein Name |
Transcription factor 7-like 1 |
| Protein Accession # |
NP_112573 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_031283 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TCF7L1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86% |
| Image 1 | Human 293T
 | WB Suggested Anti-TCF7L1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate |
|
| Image 2 | Human Fetal Liver
 | Host: Rabbit
Target Name: TCF7L1
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml |
|
| Image 3 | Human Fetal Lung
 | Host: Rabbit
Target Name: TCF7L1
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml |
|
