website statistics
Product Datasheet: ARP57828_P050 - PRKACA antibody - N-terminal region (ARP57828_P050) - Aviva Systems Biology
 
PRKACA antibody - N-terminal region (ARP57828_P050)
Data Sheet
 
Product Number ARP57828_P050
Product Page www.avivasysbio.com/prkaca-antibody-n-terminal-region-arp57828-p050.html
Product Name PRKACA antibody - N-terminal region (ARP57828_P050)
Size 100 ul
Gene Symbol PRKACA
Alias Symbols MGC102831, MGC48865, PKACA
Protein Size (# AA) 343 amino acids
Molecular Weight 40
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 5566
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Protein kinase, cAMP-dependent, catalytic, alpha
Description This is a rabbit polyclonal antibody against PRKACA. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV
Description of Target cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is a member of the Ser/Thr protein kinase family and is a catalytic subunit of cAMP-dependent protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Protein Interactions MAPT; UBC; PALM2-AKAP2; NASP; MARCKS; CALU; CALR; TRMT10A; ARPC5L; AARSD1; UGDH; TPD52; SH3GL1; RPA2; SH3GLB1; UBQLN2; ARPC1A; ARPC2; ARPC3; ARPC5; smo; CYP3A4; GNA13; DYRK1B; TBXA2R; ITGA2B; GSK3B; PDE4D; EGFR; CALD1; BAD; HSP90AB1; HSP90AA1; C2orf88; CD
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-PRKACA (ARP57828_P050) antibody is Catalog # AAP57828 (Previous Catalog # AAPP43102)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PRKACA
Complete computational species homology data Anti-PRKACA (ARP57828_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PRKACA.
Swissprot Id A8K8B9
Protein Name cDNA FLJ77368, highly similar to Homo sapiens protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 2, mRNA EMBL BAF84973.1
Protein Accession # NP_997401
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PRKACA.
Nucleotide Accession # NM_207518
Replacement Item This antibody may replace item sc-111700 from Santa Cruz Biotechnology.
Conjugation Options

ARP57828_P050-FITC Conjugated

ARP57828_P050-HRP Conjugated

ARP57828_P050-Biotin Conjugated

CB Replacement sc-111700; sc-28315; sc-28316; sc-28892; sc-30666; sc-30668; sc-30669; sc-36237; sc-36240; sc-36241; sc-365615; sc-390548; sc-48412; sc-514087; sc-515038; sc-515039; sc-903
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Sheep: 100%; Zebrafish: 86%
Image 1
Human Muscle
WB Suggested Anti-PRKACA Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle
Image 2
Human heart
Rabbit Anti-PRKACA Antibody
Catalog Number: ARP57828_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic
Primary Antibody Concentration: N/A
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com