ASB3 Antibody - middle region (ARP57739_P050)

Data Sheet
 
Product Number ARP57739_P050
Product Page www.avivasysbio.com/asb3-antibody-middle-region-arp57739-p050.html
Name ASB3 Antibody - middle region (ARP57739_P050)
Protein Size (# AA) 445 amino acids
Molecular Weight 49kDa
NCBI Gene Id 51130
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ankyrin repeat and SOCS box containing 3
Alias Symbols ASB-3
Peptide Sequence Synthetic peptide located within the following region: LEIRSSLKSERLRSDSYISQLPLPRSLHNYLLYEDVLRMYEVPELAAIQD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants have been described for this gene but some of the full length sequences are not known.
Protein Interactions PGAM5; ASB6; DNPEP; EPB41L3; CLASP2; SLC4A1AP; THRAP3; BCLAF1; PRDX6; CUL5; TCEB2; TCEB1; SRP14; SFPQ; RPS27; RPL38; RCN2; NONO; ERH; ATP5F1; ATP5C1; SLC25A5; AGL; PRMT6; KDM1A; ZAP70; HSP90AA1; DCUN1D1; ELAVL1; TNFRSF1B; S100A9; S100A8;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ASB3 (ARP57739_P050) antibody
Blocking Peptide For anti-ASB3 (ARP57739_P050) antibody is Catalog # AAP57739 (Previous Catalog # AAPP44091)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ASB3
Uniprot ID D6W5B5
Protein Name Ankyrin repeat and SOCS box protein 3
Protein Accession # NP_665862
Purification Affinity Purified
Nucleotide Accession # NM_145863
Tested Species Reactivity Human
Gene Symbol ASB3
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Rat: 86%
Image 1
Human A549
WB Suggested Anti-ASB3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: A549 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com