| Product Number |
ARP57685_P050 |
| Product Page |
www.avivasysbio.com/pkib-antibody-middle-region-arp57685-p050.html |
| Name |
Pkib Antibody - middle region (ARP57685_P050) |
| Protein Size (# AA) |
109 amino acids |
| Molecular Weight |
12kDa |
| NCBI Gene Id |
24678 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Protein kinase (cAMP-dependent, catalytic) inhibitor beta |
| Alias Symbols |
PKINH, Prkacn2, RATPKINH |
| Peptide Sequence |
Synthetic peptide located within the following region: TDVESVISSFASSARAGRRNALPDIQSSLATGGSPDLALKLEALAVKEDA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Pkib displays strong inhibition of the activity of cAMP-dependent protein kinase. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Pkib (ARP57685_P050) antibody |
| Blocking Peptide |
For anti-Pkib (ARP57685_P050) antibody is Catalog # AAP57685 (Previous Catalog # AAPP42115) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Uniprot ID |
Q8R4R3 |
| Protein Name |
Protein kinase inhibitor beta, cAMP dependent, catalytic, isoform CRA_a EMBL EDL92889.1 |
| Protein Accession # |
NP_001070021 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001076553 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Pkib |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 90%; Dog: 90%; Goat: 85%; Guinea Pig: 92%; Horse: 90%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Rat Kidney
 | WB Suggested Anti-Pkib Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Kidney |
|
|
