Tekt3 antibody - N-terminal region (ARP57677_P050)
Data Sheet
Product Number ARP57677_P050
Product Page www.avivasysbio.com/tekt3-antibody-n-terminal-region-arp57677-p050.html
Product Name Tekt3 antibody - N-terminal region (ARP57677_P050)
Size 100 ul
Gene Symbol Tekt3
Alias Symbols -
Protein Size (# AA) 490 amino acids
Molecular Weight 54kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 287392
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Tektin 3
Description This is a rabbit polyclonal antibody against Tekt3. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: MLPFVSNRTTLFTRYTPDDWYRSTLVGFQESNCSRHNSERLRVDTSRLIQ
Description of Target Tekt3 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules. It is required for progressive sperm mobility.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-Tekt3 (ARP57677_P050) antibody is Catalog # AAP57677 (Previous Catalog # AAPP42108)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Rat
Complete computational species homology data Anti-Tekt3 (ARP57677_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Tekt3.
Swissprot Id Q4V8G8
Protein Name Tektin-3
Protein Accession # NP_001019910
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Tekt3.
Nucleotide Accession # NM_001024739
Replacement Item This antibody may replace item sc-136917 from Santa Cruz Biotechnology.
Conjugation Options

ARP57677_P050-FITC Conjugated

ARP57677_P050-HRP Conjugated

ARP57677_P050-Biotin Conjugated

CB Replacement sc-136917
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 93%
Image 1
Rat Muscle
WB Suggested Anti-Tekt3 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Muscle

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com