| Product Number |
ARP57663_P050 |
| Product Page |
www.avivasysbio.com/bbs1-antibody-n-terminal-region-arp57663-p050.html |
| Name |
Bbs1 Antibody - N-terminal region (ARP57663_P050) |
| Protein Size (# AA) |
593 amino acids |
| Molecular Weight |
65kDa |
| NCBI Gene Id |
52028 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Bardet-Biedl syndrome 1 (human) |
| Alias Symbols |
AI451249, D19Ertd609, D19Ertd609e |
| Peptide Sequence |
Synthetic peptide located within the following region: PCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLTLKEMLEDI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Bbs1 (ARP57663_P050) antibody |
| Blocking Peptide |
For anti-Bbs1 (ARP57663_P050) antibody is Catalog # AAP57663 (Previous Catalog # AAPP42008) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q3V3N7 |
| Protein Name |
Protein Bbs1 Ensembl ENSMUSP00000055321 |
| Protein Accession # |
NP_001028300 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001033128 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Bbs1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100% |
| Image 1 | Mouse Liver
 | WB Suggested Anti-Bbs1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Mouse liver |
|
|
