ATPAF1 Antibody - N-terminal region (ARP57651_P050)

Data Sheet
 
Product Number ARP57651_P050
Product Page www.avivasysbio.com/atpaf1-antibody-n-terminal-region-arp57651-p050.html
Name ATPAF1 Antibody - N-terminal region (ARP57651_P050)
Protein Size (# AA) 260 amino acids
Molecular Weight 29kDa
NCBI Gene Id 64756
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name ATP synthase mitochondrial F1 complex assembly factor 1
Alias Symbols ATP11, ATP11p
Peptide Sequence Synthetic peptide located within the following region: GLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.
Protein Interactions UBC; ATP5B; ATP5A1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ATPAF1 (ARP57651_P050) antibody
Blocking Peptide For anti-ATPAF1 (ARP57651_P050) antibody is Catalog # AAP57651 (Previous Catalog # AAPP42038)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ATPAF1
Uniprot ID A8MRA7
Protein Name ATP synthase mitochondrial F1 complex assembly factor 1 Ensembl ENSP00000330685
Protein Accession # NP_001036011
Purification Affinity Purified
Nucleotide Accession # NM_001042546
Tested Species Reactivity Human
Gene Symbol ATPAF1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Rabbit: 79%; Rat: 86%
Image 1
Human MCF-7
WB Suggested Anti-ATPAF1 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com