Product Number |
ARP57651_P050 |
Product Page |
www.avivasysbio.com/atpaf1-antibody-n-terminal-region-arp57651-p050.html |
Name |
ATPAF1 Antibody - N-terminal region (ARP57651_P050) |
Protein Size (# AA) |
260 amino acids |
Molecular Weight |
29kDa |
NCBI Gene Id |
64756 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
ATP synthase mitochondrial F1 complex assembly factor 1 |
Alias Symbols |
ATP11, ATP11p |
Peptide Sequence |
Synthetic peptide located within the following region: GLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined. |
Protein Interactions |
UBC; ATP5B; ATP5A1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ATPAF1 (ARP57651_P050) antibody |
Blocking Peptide |
For anti-ATPAF1 (ARP57651_P050) antibody is Catalog # AAP57651 (Previous Catalog # AAPP42038) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ATPAF1 |
Uniprot ID |
A8MRA7 |
Protein Name |
ATP synthase mitochondrial F1 complex assembly factor 1 Ensembl ENSP00000330685 |
Protein Accession # |
NP_001036011 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001042546 |
Tested Species Reactivity |
Human |
Gene Symbol |
ATPAF1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Rabbit: 79%; Rat: 86% |
Image 1 | Human MCF-7
| WB Suggested Anti-ATPAF1 Antibody Titration: 0.2-1 ug/ml Positive Control: MCF7 cell lysate |
|
|