NAP1L2 Antibody - middle region (ARP57574_P050)

• Product Number: ARP57574_P050
• Name: NAP1L2 Antibody - middle region (ARP57574_P050)
• Protein Size (# AA): 460 amino acids
• Molecular Weight: 52kDa
• NCBI Gene Id: 4674
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Nucleosome assembly protein 1-like 2
• Alias Symbols: BPX
• Peptide Sequence: Synthetic peptide located within the following region: VDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a member of the nucleosome assembly protein (NAP) family. The function of this family member is unknown; however, mouse studies suggest that it represents a class of tissue-specific factors interacting with chromatin to regulate neuronal cell proliferation.
• Protein Interactions: PPP3R1; CUL1; UBC; SP110;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-NAP1L2 (ARP57574_P050) antibody is Catalog # AAP57574 (Previous Catalog # AAPP41745)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NAP1L2
• Uniprot ID: P51860
• Protein Name: Nucleosome assembly protein 1-like 2
• Protein Accession #: NP_068798
• Purification: Affinity Purified
• Nucleotide Accession #: NM_021963
• Tested Species Reactivity: Human
• Gene Symbol: NAP1L2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Image 1: Human HepG2
  
  WB Suggested Anti-NAP1L2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate