| Product Number |
ARP57449_P050 |
| Product Page |
www.avivasysbio.com/wdr35-antibody-n-terminal-region-arp57449-p050.html |
| Name |
WDR35 Antibody - N-terminal region (ARP57449_P050) |
| Protein Size (# AA) |
1170 amino acids |
| Molecular Weight |
132kDa |
| NCBI Gene Id |
57539 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
WD repeat domain 35 |
| Alias Symbols |
CED2, IFTA1, SRTD7, FAP118, IFT121 |
| Peptide Sequence |
Synthetic peptide located within the following region: SGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity of some variants has not been determined. |
| Protein Interactions |
CUL3; UBC; ALYREF; BCL6; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-WDR35 (ARP57449_P050) antibody |
| Blocking Peptide |
For anti-WDR35 (ARP57449_P050) antibody is Catalog # AAP57449 (Previous Catalog # AAPP41443) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human WDR35 |
| Uniprot ID |
Q9P2L0-2 |
| Protein Name |
WD repeat-containing protein 35 |
| Protein Accession # |
NP_065830 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_020779 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
WDR35 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 93% |
| Image 1 | Human Lung
 | WB Suggested Anti-WDR35 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung |
|
|
