Product Number |
ARP57311_P050 |
Product Page |
www.avivasysbio.com/apbb1ip-antibody-n-terminal-region-arp57311-p050.html |
Name |
Apbb1ip Antibody - N-terminal region (ARP57311_P050) |
Protein Size (# AA) |
664 amino acids |
Molecular Weight |
74kDa |
NCBI Gene Id |
307171 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein |
Alias Symbols |
Apbb1ip |
Peptide Sequence |
Synthetic peptide located within the following region: PPREEFNFSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of Apbb1ip remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Apbb1ip (ARP57311_P050) antibody |
Blocking Peptide |
For anti-Apbb1ip (ARP57311_P050) antibody is Catalog # AAP57311 (Previous Catalog # AAPP41127) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
Protein Accession # |
NP_001094047 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001100577 |
Tested Species Reactivity |
Rat |
Gene Symbol |
Apbb1ip |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Image 1 | Rat Liver
| WB Suggested Anti-Apbb1ip Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Rat Liver |
|
|