LANCL2 Antibody - middle region (ARP57285_P050)

Data Sheet
 
Product Number ARP57285_P050
Product Page www.avivasysbio.com/lancl2-antibody-middle-region-arp57285-p050.html
Name LANCL2 Antibody - middle region (ARP57285_P050)
Protein Size (# AA) 450 amino acids
Molecular Weight 51kDa
NCBI Gene Id 55915
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name LanC lantibiotic synthetase component C-like 2 (bacterial)
Alias Symbols TASP, GPR69B
Peptide Sequence Synthetic peptide located within the following region: LQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target LANCL2 is necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.
Protein Interactions APPBP2; UBC; EGFR; MON1B; CDK9; APP; TERF2IP; TERF2; TCF3; OTUD5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LANCL2 (ARP57285_P050) antibody
Blocking Peptide For anti-LANCL2 (ARP57285_P050) antibody is Catalog # AAP57285 (Previous Catalog # AAPP41046)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LANCL2
Uniprot ID Q9NS86
Protein Name LanC-like protein 2
Protein Accession # NP_061167
Purification Affinity Purified
Nucleotide Accession # NM_018697
Tested Species Reactivity Human
Gene Symbol LANCL2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 100%
Image 1
Human Placenta
WB Suggested Anti-LANCL2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Placenta
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com