| Product Number |
ARP57224_P050 |
| Product Page |
www.avivasysbio.com/mns1-antibody-middle-region-arp57224-p050.html |
| Name |
MNS1 Antibody - middle region (ARP57224_P050) |
| Protein Size (# AA) |
495 amino acids |
| Molecular Weight |
60kDa |
| NCBI Gene Id |
55329 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
meiosis specific nuclear structural 1 |
| Alias Symbols |
HTX9, SPATA40 |
| Peptide Sequence |
Synthetic peptide located within the following region: KVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a protein highly similar to the mouse meiosis-specific nuclear structural 1 protein. The mouse protein was shown to be expressed at the pachytene stage during spermatogenesis and may function as a nuclear skeletal protein to regulate nuc |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MNS1 (ARP57224_P050) antibody |
| Blocking Peptide |
For anti-MNS1 (ARP57224_P050) antibody is Catalog # AAP57224 (Previous Catalog # AAPP40931) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MNS1 |
| Uniprot ID |
Q8NEH6 |
| Protein Name |
Meiosis-specific nuclear structural protein 1 |
| Protein Accession # |
NP_060835 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_018365 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MNS1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 93% |
| Image 1 | Human HeLa
 | WB Suggested Anti-MNS1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate |
|
|
