MNS1 Antibody - N-terminal region (ARP57223_P050)

• Product Number: ARP57223_P050
• Name: MNS1 Antibody - N-terminal region (ARP57223_P050)
• Protein Size (# AA): 495 amino acids
• Molecular Weight: 60kDa
• NCBI Gene Id: 55329
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Meiosis-specific nuclear structural 1
• Alias Symbols: HTX9, SPATA40
• Peptide Sequence: Synthetic peptide located within the following region: EKLAMELAKLKHESLKDEKMRQQVRENSIELRELEKKLKAAYMNKERAAQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a protein highly similar to the mouse meiosis-specific nuclear structural 1 protein. The mouse protein was shown to be expressed at the pachytene stage during spermatogenesis and may function as a nuclear skeletal protein to regulate nuclear morphology during meiosis.
• Protein Interactions: MNS1; KDM1A; EWSR1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MNS1 (ARP57223_P050) antibody is Catalog # AAP57223 (Previous Catalog # AAPP40930)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MNS1
• Uniprot ID: Q8NEH6
• Protein Name: Meiosis-specific nuclear structural protein 1
• Protein Accession #: NP_060835
• Purification: Affinity Purified
• Nucleotide Accession #: NM_018365
• Tested Species Reactivity: Human
• Gene Symbol: MNS1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 75%
• Image 1: Human 721_B
  
  WB Suggested Anti-MNS1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: 721_B cell lysate