| Product Number |
ARP57199_P050 |
| Product Page |
www.avivasysbio.com/tdp1-antibody-middle-region-arp57199-p050.html |
| Name |
Tdp1 Antibody - middle region (ARP57199_P050) |
| Protein Size (# AA) |
579 amino acids |
| Molecular Weight |
64kDa |
| NCBI Gene Id |
104884 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Tyrosyl-DNA phosphodiesterase 1 |
| Alias Symbols |
SC, SCAN1, Gm40556, MLZ-501, AI838772, AW493413, 2810481F14Rik, 4921509N21Rik, E430034L06Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: ETNVYLIGSTPGRFQGSHRDNWGHFRLRKLLQAHAPSTPKGECWPIVGQF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Tdp1 is a DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 3'-phosphodiester bond, giving rise to DNA with a free 3' phosphate. It catalyzes the hydrolysis of dead-end complexes between DNA and the topoisomerase I active site tyrosine residue. It hydrolyzes 3'-phosphoglycolates on protruding 3' ends on DNA double-strand breaks due to DNA damage by radiation and free radicals. It acts on blunt-ended double-strand DNA breaks and on single-stranded DNA. It has low 3'exonuclease activity and can remove a single nucleoside from the 3'end of DNA and RNA molecules with 3'hydroxyl groups. It has no exonuclease activity towards DNA or RNA with a 3'phosphate. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Tdp1 (ARP57199_P050) antibody |
| Blocking Peptide |
For anti-Tdp1 (ARP57199_P050) antibody is Catalog # AAP57199 (Previous Catalog # AAPP40906) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q8BJ37 |
| Protein Accession # |
NP_082630 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_028354 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Tdp1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100% |
| Image 1 | Mouse Brain
 | WB Suggested Anti-Tdp1 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Brain |
|
|
