| Product Number |
ARP57076_P050 |
| Product Page |
www.avivasysbio.com/wipi1-antibody-middle-region-arp57076-p050.html |
| Name |
WIPI1 Antibody - middle region (ARP57076_P050) |
| Protein Size (# AA) |
446 amino acids |
| Molecular Weight |
49kDa |
| NCBI Gene Id |
55062 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
WD repeat domain, phosphoinositide interacting 1 |
| Alias Symbols |
ATG18, ATG18A, WIPI49 |
| Peptide Sequence |
Synthetic peptide located within the following region: LLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Eastman,S.W., (2007) FEBS Lett. 581 (18), 3396-3404 |
| Description of Target |
WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI su |
| Protein Interactions |
ESR1; AR; ATG2A; HNRNPA3P1; PKP1; LGALS7; KCTD15; ESR2; PPA1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-WIPI1 (ARP57076_P050) antibody |
| Blocking Peptide |
For anti-WIPI1 (ARP57076_P050) antibody is Catalog # AAP57076 (Previous Catalog # AAPP40620) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human WIPI1 |
| Uniprot ID |
Q5MNZ9 |
| Protein Name |
WD repeat domain phosphoinositide-interacting protein 1 |
| Protein Accession # |
NP_060453 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_017983 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
WIPI1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93% |
| Image 1 | Human 293T
 | WB Suggested Anti-WIPI1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate |
|
| Image 2 | Human Fetal Heart
 | Host: Rabbit
Target Name: WIPI1
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml |
|
| Image 3 | Human Fetal Lung
 | Host: Rabbit
Target Name: WIPI1
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml |
|
