Product Number |
ARP56749_P050 |
Product Page |
www.avivasysbio.com/prr5-antibody-n-terminal-region-arp56749-p050.html |
Name |
PRR5 Antibody - N-terminal region (ARP56749_P050) |
Protein Size (# AA) |
379 amino acids |
Molecular Weight |
41kDa |
NCBI Gene Id |
55615 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Proline rich 5 (renal) |
Alias Symbols |
PP610, PROTOR1, PROTOR-1, FLJ20185k |
Peptide Sequence |
Synthetic peptide located within the following region: NSIHNGVIAVFQRKGLPDQELFSLNEGVRQLLKTELGSFFTEYLQNQLLT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis. Rare read-through transcripts, containing exons from the ARHGAP8 gene which is located immediately downstream, led to the original description of PRR5 and ARHGAP8 as a single gene. Alternative splicing and the use of alternative promoters results in transcripts encoding different isoforms. |
Protein Interactions |
MTOR; BRCA1; UBC; RICTOR; MAPKAP1; MLST8; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PRR5 (ARP56749_P050) antibody |
Blocking Peptide |
For anti-PRR5 (ARP56749_P050) antibody is Catalog # AAP56749 (Previous Catalog # AAPP39607) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PRR5 |
Uniprot ID |
B3KRM4 |
Protein Name |
cDNA FLJ34565 fis, clone KIDNE2006210, highly similar to Homo sapiens proline rich protein 5 (PRR5), transcript variant 1, mRNA EMBL BAG52436.1 |
Sample Type Confirmation |
PRR5 is supported by BioGPS gene expression data to be expressed in COLO205 |
Protein Accession # |
NP_056181 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_015366 |
Tested Species Reactivity |
Human |
Gene Symbol |
PRR5 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100% |
Image 1 | Human COLO205
| WB Suggested Anti-PRR5 Antibody Titration: 0.2-1 ug/ml Positive Control: COLO205 cell lysatePRR5 is supported by BioGPS gene expression data to be expressed in COLO205 |
|