PRR5 Antibody - N-terminal region (ARP56749_P050)

Data Sheet
 
Product Number ARP56749_P050
Product Page www.avivasysbio.com/prr5-antibody-n-terminal-region-arp56749-p050.html
Name PRR5 Antibody - N-terminal region (ARP56749_P050)
Protein Size (# AA) 379 amino acids
Molecular Weight 41kDa
NCBI Gene Id 55615
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Proline rich 5 (renal)
Alias Symbols PP610, PROTOR1, PROTOR-1, FLJ20185k
Peptide Sequence Synthetic peptide located within the following region: NSIHNGVIAVFQRKGLPDQELFSLNEGVRQLLKTELGSFFTEYLQNQLLT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis. Rare read-through transcripts, containing exons from the ARHGAP8 gene which is located immediately downstream, led to the original description of PRR5 and ARHGAP8 as a single gene. Alternative splicing and the use of alternative promoters results in transcripts encoding different isoforms.
Protein Interactions MTOR; BRCA1; UBC; RICTOR; MAPKAP1; MLST8;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PRR5 (ARP56749_P050) antibody
Blocking Peptide For anti-PRR5 (ARP56749_P050) antibody is Catalog # AAP56749 (Previous Catalog # AAPP39607)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PRR5
Uniprot ID B3KRM4
Protein Name cDNA FLJ34565 fis, clone KIDNE2006210, highly similar to Homo sapiens proline rich protein 5 (PRR5), transcript variant 1, mRNA EMBL BAG52436.1
Sample Type Confirmation

PRR5 is supported by BioGPS gene expression data to be expressed in COLO205

Protein Accession # NP_056181
Purification Affinity Purified
Nucleotide Accession # NM_015366
Tested Species Reactivity Human
Gene Symbol PRR5
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Image 1
Human COLO205
WB Suggested Anti-PRR5 Antibody Titration: 0.2-1 ug/ml
Positive Control: COLO205 cell lysatePRR5 is supported by BioGPS gene expression data to be expressed in COLO205
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com