| Product Number |
ARP56677_P050 |
| Product Page |
www.avivasysbio.com/pfkfb2-antibody-c-terminal-region-arp56677-p050.html |
| Name |
Pfkfb2 Antibody - C-terminal region (ARP56677_P050) |
| Protein Size (# AA) |
518 amino acids |
| Molecular Weight |
57kDa |
| NCBI Gene Id |
18640 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 |
| Description |
|
| Alias Symbols |
4930568D07Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: EMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
Nphp4; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Pfkfb2 (ARP56677_P050) antibody |
| Blocking Peptide |
For anti-Pfkfb2 (ARP56677_P050) antibody is Catalog # AAP56677 (Previous Catalog # AAPP39430) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q6GTL7 |
| Protein Name |
6-phosphofructo-2-kinase Ensembl ENSMUSP00000133073 Ensembl ENSMUSP00000066426 |
| Protein Accession # |
NP_032851 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_008825 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Pfkfb2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 79%; Zebrafish: 86% |
| Image 1 | Mouse Heart
 | WB Suggested Anti-Pfkfb2 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Heart |
|
|
