Product Number |
ARP56183_P050 |
Product Page |
www.avivasysbio.com/chac2-antibody-n-terminal-region-arp56183-p050.html |
Name |
CHAC2 Antibody - N-terminal region (ARP56183_P050) |
Protein Size (# AA) |
184 amino acids |
Molecular Weight |
21kDa |
NCBI Gene Id |
494143 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
ChaC, cation transport regulator homolog 2 (E. coli) |
Alias Symbols |
GCG1 |
Peptide Sequence |
Synthetic peptide located within the following region: MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
Description of Target |
The specific function of this protein remains unknown. |
Protein Interactions |
UBC; DPYD; APP; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CHAC2 (ARP56183_P050) antibody |
Blocking Peptide |
For anti-CHAC2 (ARP56183_P050) antibody is Catalog # AAP56183 (Previous Catalog # AAPP38106) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CHAC2 |
Uniprot ID |
Q8WUX2 |
Protein Name |
Cation transport regulator-like protein 2 |
Protein Accession # |
NP_001008708 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001008708 |
Tested Species Reactivity |
Human |
Gene Symbol |
CHAC2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 100% |
Image 1 | Human Placenta
| WB Suggested Anti-CHAC2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:12500 Positive Control: Human Placenta |
|
|