| Product Number |
ARP56180_P050 |
| Product Page |
www.avivasysbio.com/rps13-antibody-middle-region-arp56180-p050.html |
| Name |
RPS13 Antibody - middle region (ARP56180_P050) |
| Protein Size (# AA) |
151 amino acids |
| Molecular Weight |
17kDa |
| NCBI Gene Id |
6207 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ribosomal protein S13 |
| Alias Symbols |
S13 |
| Peptide Sequence |
Synthetic peptide located within the following region: ILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIES |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S15P family of ribosomal proteins. It is located in the cytoplasm. The protein has been shown to bind to the 5.8S rRNA in rat. The gene product of the E. coli ortholog (ribosomal protein S15) functions at early steps in ribosome assembly. This gene is co-transcribed with two U14 small nucleolar RNA genes, which are located in its third and fifth introns. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
| Protein Interactions |
HUWE1; UBC; TP53; TUBG1; HAUS2; CEP250; ZBTB1; RNF2; TSR1; LARS; EIF3L; RPS27L; LARP1; GNB2L1; RANBP9; RPS29; RPS28; PSMD7; PSMD3; PSMC5; PSMC1; WIBG; PNO1; KCMF1; RPS27; RPS26; RPS25; RPS24; RPS23; RPS21; RPS20; RPS19; RPS18; RPS16; RPS15A; RPS14; RPS12; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RPS13 (ARP56180_P050) antibody |
| Blocking Peptide |
For anti-RPS13 (ARP56180_P050) antibody is Catalog # AAP56180 (Previous Catalog # AAPP38105) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RPS13 |
| Uniprot ID |
P62277 |
| Protein Name |
40S ribosomal protein S13 |
| Protein Accession # |
NP_001008 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001017 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RPS13 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 100% |
| Image 1 | Human THP-1
 | WB Suggested Anti-RPS13 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: THP-1 cell lysate |
|
|
