Product Number |
ARP56179_P050 |
Product Page |
www.avivasysbio.com/rps13-antibody-n-terminal-region-arp56179-p050.html |
Name |
RPS13 Antibody - N-terminal region (ARP56179_P050) |
Protein Size (# AA) |
151 amino acids |
Molecular Weight |
17kDa |
NCBI Gene Id |
6207 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Ribosomal protein S13 |
Alias Symbols |
S13 |
Peptide Sequence |
Synthetic peptide located within the following region: MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Malygin,A.A., (2007) Nucleic Acids Res. 35 (19), 6414-6423 |
Description of Target |
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro |
Protein Interactions |
HUWE1; UBC; TP53; TUBG1; HAUS2; CEP250; ZBTB1; RNF2; TSR1; LARS; EIF3L; RPS27L; LARP1; GNB2L1; RANBP9; RPS29; RPS28; PSMD7; PSMD3; PSMC5; PSMC1; WIBG; PNO1; KCMF1; RPS27; RPS26; RPS25; RPS24; RPS23; RPS21; RPS20; RPS19; RPS18; RPS16; RPS15A; RPS14; RPS12; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RPS13 (ARP56179_P050) antibody |
Blocking Peptide |
For anti-RPS13 (ARP56179_P050) antibody is Catalog # AAP56179 (Previous Catalog # AAPP38104) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human RPS13 |
Uniprot ID |
P62277 |
Protein Name |
40S ribosomal protein S13 |
Sample Type Confirmation |
RPS13 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_001008 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001017 |
Tested Species Reactivity |
Human |
Gene Symbol |
RPS13 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-RPS13 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysateRPS13 is supported by BioGPS gene expression data to be expressed in Jurkat |
|