RPS13 Antibody - N-terminal region (ARP56179_P050)

Data Sheet
 
Product Number ARP56179_P050
Product Page www.avivasysbio.com/rps13-antibody-n-terminal-region-arp56179-p050.html
Name RPS13 Antibody - N-terminal region (ARP56179_P050)
Protein Size (# AA) 151 amino acids
Molecular Weight 17kDa
NCBI Gene Id 6207
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ribosomal protein S13
Alias Symbols S13
Peptide Sequence Synthetic peptide located within the following region: MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Malygin,A.A., (2007) Nucleic Acids Res. 35 (19), 6414-6423
Description of Target Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro
Protein Interactions HUWE1; UBC; TP53; TUBG1; HAUS2; CEP250; ZBTB1; RNF2; TSR1; LARS; EIF3L; RPS27L; LARP1; GNB2L1; RANBP9; RPS29; RPS28; PSMD7; PSMD3; PSMC5; PSMC1; WIBG; PNO1; KCMF1; RPS27; RPS26; RPS25; RPS24; RPS23; RPS21; RPS20; RPS19; RPS18; RPS16; RPS15A; RPS14; RPS12;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RPS13 (ARP56179_P050) antibody
Blocking Peptide For anti-RPS13 (ARP56179_P050) antibody is Catalog # AAP56179 (Previous Catalog # AAPP38104)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RPS13
Uniprot ID P62277
Protein Name 40S ribosomal protein S13
Sample Type Confirmation

RPS13 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_001008
Purification Affinity Purified
Nucleotide Accession # NM_001017
Tested Species Reactivity Human
Gene Symbol RPS13
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-RPS13 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateRPS13 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com