Product Number |
ARP56134_P050 |
Product Page |
www.avivasysbio.com/rpl30-antibody-middle-region-arp56134-p050.html |
Name |
RPL30 Antibody - middle region (ARP56134_P050) |
Protein Size (# AA) |
115 amino acids |
Molecular Weight |
13kDa |
NCBI Gene Id |
6156 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Ribosomal protein L30 |
Alias Symbols |
L30 |
Peptide Sequence |
Synthetic peptide located within the following region: MLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Beausoleil,S.A., (2006) Nat. Biotechnol. 24 (10), 1285-1292 |
Description of Target |
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL30 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene encoding RPL30 is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
Protein Interactions |
UBC; CEP76; CEP250; CEP57; VCP; TP53; AURKA; MDM2; WWOX; ZBTB1; EED; USP14; ICAM1; IGSF8; PAN2; OAS1; ITGA4; IL7R; FN1; UBL4A; VCAM1; RPS11; MAP2K7; ZFAND2A; FAM120B; G0S2; RPL13A; CASP2; PA2G4; RPS29; RPS26; RPS24; RPS23; RPS21; RPS16; RPS15A; RPS14; RPS |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RPL30 (ARP56134_P050) antibody |
Blocking Peptide |
For anti-RPL30 (ARP56134_P050) antibody is Catalog # AAP56134 (Previous Catalog # AAPP37907) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RPL30 |
Uniprot ID |
P62888 |
Protein Name |
60S ribosomal protein L30 |
Sample Type Confirmation |
RPL30 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_000980 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000989 |
Tested Species Reactivity |
Human |
Gene Symbol |
RPL30 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-RPL30 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysateRPL30 is supported by BioGPS gene expression data to be expressed in Jurkat |
|