RPL30 Antibody - middle region (ARP56133_P050)

Data Sheet
 
Product Number ARP56133_P050
Product Page www.avivasysbio.com/rpl30-antibody-middle-region-arp56133-p050.html
Name RPL30 Antibody - middle region (ARP56133_P050)
Protein Size (# AA) 115 amino acids
Molecular Weight 13kDa
NCBI Gene Id 6156
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ribosomal protein L30
Alias Symbols L30
Peptide Sequence Synthetic peptide located within the following region: LKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Beausoleil,S.A., (2006) Nat. Biotechnol. 24 (10), 1285-1292
Description of Target Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL30 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene encoding RPL30 is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Protein Interactions UBC; CEP76; CEP250; CEP57; VCP; TP53; AURKA; MDM2; WWOX; ZBTB1; EED; USP14; ICAM1; IGSF8; PAN2; OAS1; ITGA4; IL7R; FN1; UBL4A; VCAM1; RPS11; MAP2K7; ZFAND2A; FAM120B; G0S2; RPL13A; CASP2; PA2G4; RPS29; RPS26; RPS24; RPS23; RPS21; RPS16; RPS15A; RPS14; RPS
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RPL30 (ARP56133_P050) antibody
Blocking Peptide For anti-RPL30 (ARP56133_P050) antibody is Catalog # AAP56133 (Previous Catalog # AAPP37906)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RPL30
Uniprot ID P62888
Protein Name 60S ribosomal protein L30
Protein Accession # NP_000980
Purification Affinity Purified
Nucleotide Accession # NM_000989
Tested Species Reactivity Human
Gene Symbol RPL30
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Placenta
WB Suggested Anti-RPL30 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com