| Product Number |
ARP56121_P050 |
| Product Page |
www.avivasysbio.com/blvrb-antibody-middle-region-arp56121-p050.html |
| Name |
BLVRB Antibody - middle region (ARP56121_P050) |
| Protein Size (# AA) |
206 amino acids |
| Molecular Weight |
22kDa |
| NCBI Gene Id |
645 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Biliverdin reductase B (flavin reductase (NADPH)) |
| Alias Symbols |
FLR, BVRB, SDR43U1, HEL-S-10 |
| Peptide Sequence |
Synthetic peptide located within the following region: GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Smith,L.J., (2008) Biochem. J. 411 (3), 475-484 |
| Description of Target |
BLVRB catalyzes electron transfer from reduced pyridine nucleotides to flavins as well as methylene blue, pyrroloquinoline quinone, riboflavin, or methemoglobin. BLVRB has possible role in protecting cells from oxidative damage or in regulating iron metabolism. In the liver, BLVRB converts biliverdin to bilirubin. |
| Protein Interactions |
SUMO1; NEDD8; UBC; RPL31; ORM1; GMDS; HMOX1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-BLVRB (ARP56121_P050) antibody |
| Blocking Peptide |
For anti-BLVRB (ARP56121_P050) antibody is Catalog # AAP56121 (Previous Catalog # AAPP37742) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human BLVRB |
| Uniprot ID |
P30043 |
| Protein Name |
Flavin reductase (NADPH) |
| Protein Accession # |
NP_000704 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000713 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
BLVRB |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100% |
| Image 1 | Human Liver
 | WB Suggested Anti-BLVRB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver |
|
