MAOA Antibody - N-terminal region (ARP56074_P050)

• Product Number: ARP56074_P050
• Name: MAOA Antibody - N-terminal region (ARP56074_P050)
• Protein Size (# AA): 527 amino acids
• Molecular Weight: 60kDa
• NCBI Gene Id: 4128
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Monoamine oxidase A
• Alias Symbols: BRNRS, MAO-A
• Peptide Sequence: Synthetic peptide located within the following region: GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Shiels,M.S., (2008) Prev Med 47 (1), 116-122
• Description of Target: MAOA catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.This gene encodes monoamine oxidase A, an enzyme that degrades amine neurotransmitters, such as dopamine, norepinephrine, and serotonin. The protein localizes to the mitochondrial outer membrane. The gene is adjacent to a related gene on the opposite strand of chromosome X. Mutation in this gene results in monoamine oxidase deficiency, or Brunner syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: NDRG1; UBC; MAOA;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MAOA (ARP56074_P050) antibody is Catalog # AAP56074 (Previous Catalog # AAPP37539)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAOA
• Uniprot ID: P21397
• Protein Name: Amine oxidase [flavin-containing] A
• Protein Accession #: NP_000231
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000240
• Tested Species Reactivity: Human
• Gene Symbol: MAOA
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
• Image 1: Human Lung
  
  WB Suggested Anti-MAOA Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Human Lung