Product Number |
ARP56050_P050 |
Product Page |
www.avivasysbio.com/mgat4d-antibody-middle-region-arp56050-p050.html |
Name |
MGAT4D Antibody - middle region (ARP56050_P050) |
Protein Size (# AA) |
166 amino acids |
Molecular Weight |
18kDa |
NCBI Gene Id |
152586 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
MGAT4 family member D |
Alias Symbols |
GnT1IP |
Peptide Sequence |
Synthetic peptide located within the following region: KPIDWLLNDIFQVKVCDAGEDLRNCMKRKKQIRIQYKPSLFQHVGIHSSF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-MGAT4D (ARP56050_P050) antibody |
Blocking Peptide |
For anti-MGAT4D (ARP56050_P050) antibody is Catalog # AAP56050 (Previous Catalog # AAPP37515) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LOC152586 |
Uniprot ID |
D6RCD3 |
Protein Name |
alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like protein MGAT4D |
Protein Accession # |
XP_001720300 |
Purification |
Affinity Purified |
Nucleotide Accession # |
XM_001720248 |
Tested Species Reactivity |
Human |
Gene Symbol |
MGAT4D |
Predicted Species Reactivity |
Human, Mouse, Cow, Dog |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Dog: 77%; Human: 100%; Mouse: 77% |
Image 1 | Human THP-1
| WB Suggested Anti-LOC152586 Antibody Titration: 0.2-1 ug/ml Positive Control: THP-1 cell lysate |
|
|