MGAT4D Antibody - middle region (ARP56050_P050)

Data Sheet
 
Product Number ARP56050_P050
Product Page www.avivasysbio.com/mgat4d-antibody-middle-region-arp56050-p050.html
Name MGAT4D Antibody - middle region (ARP56050_P050)
Protein Size (# AA) 166 amino acids
Molecular Weight 18kDa
NCBI Gene Id 152586
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name MGAT4 family member D
Alias Symbols GnT1IP
Peptide Sequence Synthetic peptide located within the following region: KPIDWLLNDIFQVKVCDAGEDLRNCMKRKKQIRIQYKPSLFQHVGIHSSF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MGAT4D (ARP56050_P050) antibody
Blocking Peptide For anti-MGAT4D (ARP56050_P050) antibody is Catalog # AAP56050 (Previous Catalog # AAPP37515)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LOC152586
Uniprot ID D6RCD3
Protein Name alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like protein MGAT4D
Protein Accession # XP_001720300
Purification Affinity Purified
Nucleotide Accession # XM_001720248
Tested Species Reactivity Human
Gene Symbol MGAT4D
Predicted Species Reactivity Human, Mouse, Cow, Dog
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 77%; Dog: 77%; Human: 100%; Mouse: 77%
Image 1
Human THP-1
WB Suggested Anti-LOC152586 Antibody Titration: 0.2-1 ug/ml
Positive Control: THP-1 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com