| Product Number |
ARP56006_P050 |
| Product Page |
www.avivasysbio.com/mgc48628-antibody-n-terminal-region-arp56006-p050.html |
| Name |
MGC48628 Antibody - N-terminal region (ARP56006_P050) |
| Protein Size (# AA) |
677 amino acids |
| Molecular Weight |
74kDa |
| NCBI Gene Id |
401145 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Family with sequence similarity 190, member A |
| Alias Symbols |
FAM190A |
| Peptide Sequence |
Synthetic peptide located within the following region: HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
The specific function of the protein remains unknown. |
| Protein Interactions |
NDEL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CCSER1 (ARP56006_P050) antibody |
| Blocking Peptide |
For anti-CCSER1 (ARP56006_P050) antibody is Catalog # AAP56006 (Previous Catalog # AAPP37412) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MGC48628 |
| Uniprot ID |
Q9C0I3-2 |
| Protein Name |
Protein FAM190A |
| Protein Accession # |
NP_997374 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_207491 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CCSER1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 79%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 92%; Rat: 86% |
| Image 1 | Human Heart
 | WB Suggested Anti-MGC48628 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart |
|
|
