| Product Number |
ARP55991_P050 |
| Product Page |
www.avivasysbio.com/zp1-antibody-middle-region-arp55991-p050.html |
| Name |
ZP1 Antibody - middle region (ARP55991_P050) |
| Protein Size (# AA) |
638 amino acids |
| Molecular Weight |
70kDa |
| NCBI Gene Id |
22917 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zona pellucida glycoprotein 1 (sperm receptor) |
| Alias Symbols |
OOMD, OOMD1, HEL163 |
| Peptide Sequence |
Synthetic peptide located within the following region: PVGFEDSYGQEPTLGPTDSNGNSSLRPLLWAVLLLPAVALVLGFGVFVGL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gook,D.A., (2008) Hum. Reprod. 23 (2), 394-402 |
| Description of Target |
The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zona pellucida. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZP1 (ARP55991_P050) antibody |
| Blocking Peptide |
For anti-ZP1 (ARP55991_P050) antibody is Catalog # AAP55991 (Previous Catalog # AAPP37338) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZP1 |
| Uniprot ID |
P60852 |
| Protein Name |
Zona pellucida sperm-binding protein 1 |
| Protein Accession # |
NP_997224 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_207341 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZP1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human 293T
 | WB Suggested Anti-ZP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate |
|
|
