| Product Number |
ARP55834_P050 |
| Product Page |
www.avivasysbio.com/2610034b18rik-antibody-n-terminal-region-arp55834-p050.html |
| Name |
Arpin Antibody - N-terminal region (ARP55834_P050) |
| Protein Size (# AA) |
226 amino acids |
| Molecular Weight |
25kDa |
| NCBI Gene Id |
70420 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
actin-related protein 2/3 complex inhibitor |
| Alias Symbols |
2610034B18Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: RYYVLYIQPSCIHRRKFDPKGNEIEPNFSATRKVNTGFLMSSYKVEAKGD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-2610034B18Rik (ARP55834_P050) antibody |
| Blocking Peptide |
For anti-2610034B18Rik (ARP55834_P050) antibody is Catalog # AAP55834 (Previous Catalog # AAPP37007) |
| Uniprot ID |
Q9D0A3 |
| Protein Name |
Arpin |
| Protein Accession # |
NP_081696 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_027420 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Arpin |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Mouse Spleen
 | WB Suggested Anti-2610034B18Rik Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Spleen |
|
|
