LRRTM1 Antibody - middle region (ARP55787_P050)

• Product Number: ARP55787_P050
• Name: LRRTM1 Antibody - middle region (ARP55787_P050)
• Protein Size (# AA): 522 amino acids
• Molecular Weight: 59kDa
• NCBI Gene Id: 347730
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Leucine rich repeat transmembrane neuronal 1
• Alias Symbols: FLJ32082
• Peptide Sequence: Synthetic peptide located within the following region: RIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Francks,C., (2007) Mol. Psychiatry 12 (12), 1129-1139
• Description of Target: LRRTM1 may play a role during the development of specific forebrain structures by influencing neuronal differentiation and connectivity, with a possible role in intracellular trafficking within axons.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-LRRTM1 (ARP55787_P050) antibody is Catalog # AAP55787 (Previous Catalog # AAPP36648)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRRTM1
• Uniprot ID: Q86UE6
• Protein Name: Leucine-rich repeat transmembrane neuronal protein 1
• Protein Accession #: NP_849161
• Purification: Affinity Purified
• Nucleotide Accession #: NM_178839
• Tested Species Reactivity: Human
• Gene Symbol: LRRTM1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86%
• Image 1: Human Placenta
  
  WB Suggested Anti-LRRTM1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:12500
  Positive Control: Human Placenta