| Product Number |
ARP55783_P050 |
| Product Page |
www.avivasysbio.com/zdhhc21-antibody-middle-region-arp55783-p050.html |
| Name |
ZDHHC21 Antibody - middle region (ARP55783_P050) |
| Protein Size (# AA) |
265 amino acids |
| Molecular Weight |
31kDa |
| NCBI Gene Id |
340481 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger, DHHC-type containing 21 |
| Alias Symbols |
DNZ1, DHHC21, DHHC-21, HSPC097 |
| Peptide Sequence |
Synthetic peptide located within the following region: ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
ESR1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZDHHC21 (ARP55783_P050) antibody |
| Blocking Peptide |
For anti-ZDHHC21 (ARP55783_P050) antibody is Catalog # AAP55783 (Previous Catalog # AAPP36644) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZDHHC21 |
| Uniprot ID |
Q5RB84 |
| Protein Name |
Probable palmitoyltransferase ZDHHC21 |
| Protein Accession # |
NP_848661 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_178566 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZDHHC21 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human THP-1
 | WB Suggested Anti-ZDHHC21 Antibody Titration: 0.2-1 ug/ml
Positive Control: THP-1 cell lysate |
|
|
