UBAC2 Antibody - middle region (ARP55756_P050)

• Product Number: ARP55756_P050
• Name: UBAC2 Antibody - middle region (ARP55756_P050)
• Protein Size (# AA): 309 amino acids
• Molecular Weight: 35kDa
• NCBI Gene Id: 337867
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: UBA domain containing 2
• Alias Symbols: PHGDHL1
• Peptide Sequence: Synthetic peptide located within the following region: YCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Dunham,A., (2004) Nature 428 (6982), 522-528
• Description of Target: The specific functin of this protein remains unknown.
• Protein Interactions: CALCOCO2; UBC; TSR1; NONO; ATP6V1C1; FAF2; MME; GET4; LMO7;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-UBAC2 (ARP55756_P050) antibody is Catalog # AAP55756 (Previous Catalog # AAPP36621)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UBAC2
• Uniprot ID: Q8NBM4-2
• Protein Name: Ubiquitin-associated domain-containing protein 2
• Protein Accession #: NP_808882
• Purification: Affinity Purified
• Nucleotide Accession #: NM_177967
• Tested Species Reactivity: Human
• Gene Symbol: UBAC2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human 721_B
  
  WB Suggested Anti-UBAC2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:12500
  Positive Control: 721_B cell lysate