ZADH2 Antibody - N-terminal region (ARP55746_P050)

Data Sheet
 
Product Number ARP55746_P050
Product Page www.avivasysbio.com/zadh2-antibody-n-terminal-region-arp55746-p050.html
Name ZADH2 Antibody - N-terminal region (ARP55746_P050)
Protein Size (# AA) 377 amino acids
Molecular Weight 40kDa
NCBI Gene Id 284273
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc binding alcohol dehydrogenase domain containing 2
Alias Symbols PRG-3
Peptide Sequence Synthetic peptide located within the following region: MLRLVPTGARAIVDMSYARHFLDFQGSAIPQAMQKLVVTRLSPNFREAVT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
Description of Target The exact functions of ZADH2 remain unknown.
Protein Interactions SUMO2; PEX5; APP; LNX1; ELAVL1; Nedd4; NEDD4L; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZADH2 (ARP55746_P050) antibody
Blocking Peptide For anti-ZADH2 (ARP55746_P050) antibody is Catalog # AAP55746 (Previous Catalog # AAPP36611)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZADH2
Uniprot ID Q8N4Q0
Protein Name Zinc-binding alcohol dehydrogenase domain-containing protein 2
Protein Accession # NP_787103
Purification Affinity Purified
Nucleotide Accession # NM_175907
Tested Species Reactivity Human
Gene Symbol ZADH2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human 721_B
WB Suggested Anti-ZADH2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com