Product Number |
ARP55746_P050 |
Product Page |
www.avivasysbio.com/zadh2-antibody-n-terminal-region-arp55746-p050.html |
Name |
ZADH2 Antibody - N-terminal region (ARP55746_P050) |
Protein Size (# AA) |
377 amino acids |
Molecular Weight |
40kDa |
NCBI Gene Id |
284273 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc binding alcohol dehydrogenase domain containing 2 |
Alias Symbols |
PRG-3 |
Peptide Sequence |
Synthetic peptide located within the following region: MLRLVPTGARAIVDMSYARHFLDFQGSAIPQAMQKLVVTRLSPNFREAVT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004) |
Description of Target |
The exact functions of ZADH2 remain unknown. |
Protein Interactions |
SUMO2; PEX5; APP; LNX1; ELAVL1; Nedd4; NEDD4L; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZADH2 (ARP55746_P050) antibody |
Blocking Peptide |
For anti-ZADH2 (ARP55746_P050) antibody is Catalog # AAP55746 (Previous Catalog # AAPP36611) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZADH2 |
Uniprot ID |
Q8N4Q0 |
Protein Name |
Zinc-binding alcohol dehydrogenase domain-containing protein 2 |
Protein Accession # |
NP_787103 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_175907 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZADH2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human 721_B
| WB Suggested Anti-ZADH2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: 721_B cell lysate |
|
|