Product Number |
ARP55738_P050 |
Product Page |
www.avivasysbio.com/rab37-antibody-middle-region-arp55738-p050.html |
Name |
RAB37 Antibody - middle region (ARP55738_P050) |
Protein Size (# AA) |
216 amino acids |
Molecular Weight |
24kDa |
NCBI Gene Id |
326624 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
RAB37, member RAS oncogene family |
Alias Symbols |
FLJ30284, FLJ32507 |
Peptide Sequence |
Synthetic peptide located within the following region: ERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Rab proteins are low molecular mass GTPases that are critical regulators of vesicle trafficking. For additional background information on Rab proteins, see MIM 179508. |
Protein Interactions |
MAL2; RABGGTB; UBC; RIMS1; RAB5A; EWSR1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RAB37 (ARP55738_P050) antibody |
Blocking Peptide |
For anti-RAB37 (ARP55738_P050) antibody is Catalog # AAP55738 (Previous Catalog # AAPP36445) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RAB37 |
Uniprot ID |
Q8IWA7 |
Protein Name |
Ras-related protein Rab-37 |
Protein Accession # |
NP_783865 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_175738 |
Tested Species Reactivity |
Human |
Gene Symbol |
RAB37 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86% |
Image 1 | Human 293T
| WB Suggested Anti-RAB37 Antibody Titration: 0.2-1 ug/ml Positive Control: Transfected 293T |
|
Image 2 | Human, Mouse
| Sample Type: 1. Human Cervical Cancer Cell Lysate (15ug) 2. Monkey Fibroblast Cell Lysate (15ug) Primary Dilution: 1:1000 Secondary Antibody: goat anti-Rabbit Secondary Dilution: 1:40,000 Image Submitted by: Dr. Jakob Szwedo, Dr. Lupashin's Lab University of Arkansas for Medical SciencesSee Customer Feedback tab for detailed information. |
|