RAB37 Antibody - middle region (ARP55738_P050)

Data Sheet
 
Product Number ARP55738_P050
Product Page www.avivasysbio.com/rab37-antibody-middle-region-arp55738-p050.html
Name RAB37 Antibody - middle region (ARP55738_P050)
Protein Size (# AA) 216 amino acids
Molecular Weight 24kDa
NCBI Gene Id 326624
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name RAB37, member RAS oncogene family
Alias Symbols FLJ30284, FLJ32507
Peptide Sequence Synthetic peptide located within the following region: ERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Rab proteins are low molecular mass GTPases that are critical regulators of vesicle trafficking. For additional background information on Rab proteins, see MIM 179508.
Protein Interactions MAL2; RABGGTB; UBC; RIMS1; RAB5A; EWSR1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RAB37 (ARP55738_P050) antibody
Blocking Peptide For anti-RAB37 (ARP55738_P050) antibody is Catalog # AAP55738 (Previous Catalog # AAPP36445)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RAB37
Uniprot ID Q8IWA7
Protein Name Ras-related protein Rab-37
Protein Accession # NP_783865
Purification Affinity Purified
Nucleotide Accession # NM_175738
Tested Species Reactivity Human
Gene Symbol RAB37
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Image 1
Human 293T
WB Suggested Anti-RAB37 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T
Image 2
Human, Mouse
Sample Type: 1. Human Cervical Cancer Cell Lysate (15ug)
2. Monkey Fibroblast Cell Lysate (15ug)
Primary Dilution: 1:1000
Secondary Antibody: goat anti-Rabbit
Secondary Dilution: 1:40,000
Image Submitted by:  Dr. Jakob Szwedo, Dr. Lupashin's Lab
University of Arkansas for Medical SciencesSee Customer Feedback tab for detailed information.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com