Product Number |
ARP55701_P050 |
Product Page |
www.avivasysbio.com/negr1-antibody-n-terminal-region-arp55701-p050.html |
Name |
NEGR1 Antibody - N-terminal region (ARP55701_P050) |
Protein Size (# AA) |
354 amino acids |
Molecular Weight |
39kDa |
NCBI Gene Id |
257194 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Neuronal growth regulator 1 |
Alias Symbols |
Ntra, KILON, IGLON4, DMML2433 |
Peptide Sequence |
Synthetic peptide located within the following region: WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
NEGR1 may be involved in cell-adhesion. NEGR1 may function as a trans-neural growth-promoting factor in regenerative axon sprouting in the mammalian brain. |
Protein Interactions |
NEGR1; NTM; LSAMP; Htt; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NEGR1 (ARP55701_P050) antibody |
Blocking Peptide |
For anti-NEGR1 (ARP55701_P050) antibody is Catalog # AAP55701 (Previous Catalog # AAPP44438) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NEGR1 |
Uniprot ID |
Q7Z3B1 |
Protein Name |
Neuronal growth regulator 1 |
Protein Accession # |
NP_776169 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_173808 |
Tested Species Reactivity |
Human |
Gene Symbol |
NEGR1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-NEGR1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
|
|