| Product Number |
ARP55668_P050 |
| Product Page |
www.avivasysbio.com/cdrt4-antibody-middle-region-arp55668-p050.html |
| Name |
CDRT4 Antibody - middle region (ARP55668_P050) |
| Protein Size (# AA) |
151 amino acids |
| Molecular Weight |
17kDa |
| NCBI Gene Id |
284040 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
CMT1A duplicated region transcript 4 |
| Alias Symbols |
FLJ36674, MGC33988, NBLA10383 |
| Peptide Sequence |
Synthetic peptide located within the following region: TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Inoue,K., (2001) Genome Res. 11 (6), 1018-1033 |
| Description of Target |
The specific function of CDRT4 is not yet known. |
| Protein Interactions |
VAC14; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CDRT4 (ARP55668_P050) antibody |
| Blocking Peptide |
For anti-CDRT4 (ARP55668_P050) antibody is Catalog # AAP55668 (Previous Catalog # AAPP36111) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CDRT4 |
| Uniprot ID |
Q8N9R6 |
| Protein Name |
CMT1A duplicated region transcript 4 protein |
| Protein Accession # |
NP_775893 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_173622 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CDRT4 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Heart
 | WB Suggested Anti-CDRT4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart |
|
|
