| Product Number |
ARP55644_P050 |
| Product Page |
www.avivasysbio.com/flj25791-antibody-middle-region-arp55644-p050.html |
| Name |
FLJ25791 Antibody - middle region (ARP55644_P050) |
| Protein Size (# AA) |
310 amino acids |
| Molecular Weight |
36kDa |
| NCBI Gene Id |
222521 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Chromosome 6 open reading frame 224 |
| Alias Symbols |
MGC126763, MGC138153, FLJ25791 |
| Peptide Sequence |
Synthetic peptide located within the following region: EYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-C6orf224 (ARP55644_P050) antibody |
| Blocking Peptide |
For anti-C6orf224 (ARP55644_P050) antibody is Catalog # AAP55644 (Previous Catalog # AAPP39505) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human FLJ25791 |
| Uniprot ID |
Q3MIS4 |
| Protein Accession # |
NP_775830 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_173559 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
C6orf224 |
| Predicted Species Reactivity |
Human, Mouse, Cow, Dog, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100% |
| Image 1 | Human 293T
 | WB Suggested Anti-FLJ25791 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate |
|
|
