TRIML2 Antibody - middle region (ARP55635_P050)

Data Sheet
 
Product Number ARP55635_P050
Product Page www.avivasysbio.com/triml2-antibody-middle-region-arp55635-p050.html
Name TRIML2 Antibody - middle region (ARP55635_P050)
Protein Size (# AA) 387 amino acids
Molecular Weight 44kDa
NCBI Gene Id 205860
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Tripartite motif family-like 2
Alias Symbols SPRYD6
Peptide Sequence Synthetic peptide located within the following region: SEDLRTMRLRHGQQDGAGNPERLDFSAMVLAAESFTSGRHYWEVDVEKAT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Description of Target The specific function of TRIML2 is not yet known.
Protein Interactions SUMO2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TRIML2 (ARP55635_P050) antibody
Blocking Peptide For anti-TRIML2 (ARP55635_P050) antibody is Catalog # AAP55635 (Previous Catalog # AAPP36012)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TRIML2
Uniprot ID Q8N7C3
Protein Name Probable E3 ubiquitin-protein ligase TRIML2
Protein Accession # NP_775824
Purification Affinity Purified
Nucleotide Accession # NM_173553
Tested Species Reactivity Human
Gene Symbol TRIML2
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Muscle
WB Suggested Anti-TRIML2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com