Product Number |
ARP55635_P050 |
Product Page |
www.avivasysbio.com/triml2-antibody-middle-region-arp55635-p050.html |
Name |
TRIML2 Antibody - middle region (ARP55635_P050) |
Protein Size (# AA) |
387 amino acids |
Molecular Weight |
44kDa |
NCBI Gene Id |
205860 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Tripartite motif family-like 2 |
Alias Symbols |
SPRYD6 |
Peptide Sequence |
Synthetic peptide located within the following region: SEDLRTMRLRHGQQDGAGNPERLDFSAMVLAAESFTSGRHYWEVDVEKAT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
Description of Target |
The specific function of TRIML2 is not yet known. |
Protein Interactions |
SUMO2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TRIML2 (ARP55635_P050) antibody |
Blocking Peptide |
For anti-TRIML2 (ARP55635_P050) antibody is Catalog # AAP55635 (Previous Catalog # AAPP36012) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TRIML2 |
Uniprot ID |
Q8N7C3 |
Protein Name |
Probable E3 ubiquitin-protein ligase TRIML2 |
Protein Accession # |
NP_775824 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_173553 |
Tested Species Reactivity |
Human |
Gene Symbol |
TRIML2 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Muscle
| WB Suggested Anti-TRIML2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle |
|
|