| Product Number |
ARP55631_P050 |
| Product Page |
www.avivasysbio.com/rfesd-antibody-middle-region-arp55631-p050.html |
| Name |
RFESD Antibody - middle region (ARP55631_P050) |
| Protein Size (# AA) |
157 amino acids |
| Molecular Weight |
18kDa |
| NCBI Gene Id |
317671 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Rieske (Fe-S) domain containing |
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: VVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
The specific function of this protein remains unknown. |
| Protein Interactions |
HBQ1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RFESD (ARP55631_P050) antibody |
| Blocking Peptide |
For anti-RFESD (ARP55631_P050) antibody is Catalog # AAP55631 (Previous Catalog # AAPP36008) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RFESD |
| Uniprot ID |
Q8TAC1 |
| Protein Name |
Rieske domain-containing protein |
| Protein Accession # |
NP_775498 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_173362 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RFESD |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%; Yeast: 100% |
| Image 1 | Human Brain
 | WB Suggested Anti-RFESD Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain |
|
|
