IL15 Antibody - N-terminal region (ARP55616_P050)

• Product Number: ARP55616_P050
• Name: IL15 Antibody - N-terminal region (ARP55616_P050)
• Protein Size (# AA): 162 amino acids
• Molecular Weight: 13kDa
• NCBI Gene Id: 3600
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Interleukin 15
• Alias Symbols: IL-15
• Peptide Sequence: Synthetic peptide located within the following region: RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Pistilli,E.E., (er) Cytokine (2008) In press
• Description of Target: IL15 is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis.The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported.
• Protein Interactions: ZNRD1; TRAF3; STAT5B; APP; IL15RA; IL2RG; IL2RB;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-IL15 (ARP55616_P050) antibody is Catalog # AAP55616 (Previous Catalog # AAPP34241)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL15
• Uniprot ID: P40933
• Protein Name: Interleukin-15
• Protein Accession #: NP_751914
• Purification: Affinity Purified
• Nucleotide Accession #: NM_172174
• Tested Species Reactivity: Human
• Gene Symbol: IL15
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
• Image 1: Human 293T
  
  WB Suggested Anti-IL15 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: 293T cell lysate
• Image 2: A549 Cell Lysate, U937 Cell Lysate
  
  Host: Rabbit
  Target: IL15
  Positive control (+): A549 Cell Lysate (N03)
  Negative control (-): U937 Cell Lysate (N31)
  Antibody concentration: 3ug/ml
• Image 3: Human RPMI 8226 Whole Cell
  
  Host: Rabbit
  Target Name: IL15
  Sample Tissue: Human RPMI 8226 Whole Cell
  Antibody Dilution: 1ug/ml