| Product Number |
ARP55590_P050 |
| Product Page |
www.avivasysbio.com/pi16-antibody-middle-region-arp55590-p050.html |
| Name |
PI16 Antibody - middle region (ARP55590_P050) |
| Protein Size (# AA) |
463 amino acids |
| Molecular Weight |
47kDa |
| NCBI Gene Id |
221476 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Peptidase inhibitor 16 |
| Alias Symbols |
CD364, PSPBP, CRISP9, MSMBBP |
| Peptide Sequence |
Synthetic peptide located within the following region: SKSLPNFPNTSATANATGGRALALQSSLPGAEGPDKPSVVSGLNSGPGHV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Reeves,J.R., Clin. Cancer Res. 12 (20 PT 1), 6018-6022 (2006) |
| Description of Target |
PI16 is a putative serine protease inhibitor. PI16 may serve as a marker following prostatectomy for prostate cancer. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PI16 (ARP55590_P050) antibody |
| Blocking Peptide |
For anti-PI16 (ARP55590_P050) antibody is Catalog # AAP55590 (Previous Catalog # AAPP36601) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PI16 |
| Uniprot ID |
Q6UXB8 |
| Protein Name |
Peptidase inhibitor 16 |
| Protein Accession # |
NP_699201 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_153370 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PI16 |
| Predicted Species Reactivity |
Human, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 93%; Horse: 92%; Human: 100%; Pig: 77% |
| Image 1 | Human 721_B
 | WB Suggested Anti-PI16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate |
|
|
