| Product Number |
ARP55489_P050 |
| Product Page |
www.avivasysbio.com/senp5-antibody-middle-region-arp55489-p050.html |
| Name |
SENP5 Antibody - middle region (ARP55489_P050) |
| Protein Size (# AA) |
755 amino acids |
| Molecular Weight |
87kDa |
| NCBI Gene Id |
205564 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SUMO1/sentrin specific peptidase 5 |
| Alias Symbols |
DKFZp564O1016, FLJ42398, MGC27076 |
| Peptide Sequence |
Synthetic peptide located within the following region: LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gong,L. (2006) J. Biol. Chem. 281 (23), 15869-15877 |
| Description of Target |
The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for numerous biologic processes. SUMO-specific proteases, such as SENP5, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates. |
| Protein Interactions |
RABGAP1; SUMO3; PASK; SUMO2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SENP5 (ARP55489_P050) antibody |
| Blocking Peptide |
For anti-SENP5 (ARP55489_P050) antibody is Catalog # AAP55489 (Previous Catalog # AAPP33381) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SENP5 |
| Uniprot ID |
Q96HI0 |
| Protein Name |
Sentrin-specific protease 5 |
| Protein Accession # |
NP_689912 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152699 |
| Tested Species Reactivity |
Human, Rat |
| Gene Symbol |
SENP5 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human 293T
 | WB Suggested Anti-SENP5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate |
|
| Image 2 | Rat
 | Sample Type: 1.Rat Testis cells (200ug)
Primary Dilution: 1:1000
Secondary Antibody: alkaline phosphatase-conjugated anti-rabbit
Secondary Dilution: 1:1000
Image Submitted by: Andreia Carvalho
IBMC-OBF, Portugal See Customer Feedback tab for detailed information.
|
|
