IQCE Antibody - middle region (ARP55486_P050)

• Product Number: ARP55486_P050
• Name: IQCE Antibody - middle region (ARP55486_P050)
• Protein Size (# AA): 695 amino acids
• Molecular Weight: 77kDa
• NCBI Gene Id: 23288
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: IQ motif containing E
• Alias Symbols: PAPA7, 1700028P05Rik
• Peptide Sequence: Synthetic peptide located within the following region: KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
• Description of Target: IQCE contains 2 IQ domains. The functions of IQCE remain unknown.
• Protein Interactions: PSMA3; CALM3; CALM2; TTC23L; LZTS2; CEP70; CARD9; RPGRIP1; HOOK2; MTUS2; SPAG5; TRIM27; GOLGA2; TRIM23;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-IQCE (ARP55486_P050) antibody is Catalog # AAP55486 (Previous Catalog # AAPP33378)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IQCE
• Uniprot ID: Q6IPM2
• Protein Name: IQ domain-containing protein E
• Protein Accession #: NP_689771
• Purification: Affinity Purified
• Nucleotide Accession #: NM_152558
• Tested Species Reactivity: Human
• Gene Symbol: IQCE
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%
• Image 1: Human Placenta
  
  WB Suggested Anti-IQCE Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Human Placenta