WDR21A Antibody - middle region (ARP55298_P050)

Data Sheet
 
Product Number ARP55298_P050
Product Page www.avivasysbio.com/wdr21a-antibody-middle-region-arp55298-p050.html
Name WDR21A Antibody - middle region (ARP55298_P050)
Protein Size (# AA) 395 amino acids
Molecular Weight 43kDa
NCBI Gene Id 26094
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name DDB1 and CUL4 associated factor 4
Alias Symbols WDR21, WDR21A
Peptide Sequence Synthetic peptide located within the following region: GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
Description of Target WDR21A is a WD repeat-containing protein. The function of WDR21A remains unknown.This gene encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Protein Interactions CUL4A; CUL4B; DDB1; SOX30; UBC; COPS5; COPS6; USP7;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DCAF4 (ARP55298_P050) antibody
Blocking Peptide For anti-DCAF4 (ARP55298_P050) antibody is Catalog # AAP55298 (Previous Catalog # AAPP33129)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human WDR21A
Uniprot ID Q8IV10
Protein Name DDB1- and CUL4-associated factor 4 Ensembl ENSP00000377781
Sample Type Confirmation

DCAF4 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_851937
Purification Affinity Purified
Nucleotide Accession # NM_181340
Tested Species Reactivity Human
Gene Symbol DCAF4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 100%; Rabbit: 93%; Rat: 86%
Image 1
Human Muscle
WB Suggested Anti-WDR21A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle
Image 2
Human Jurkat
Host: Rabbit
Target Name: DCAF4
Sample Type: Jurkat
Antibody Dilution: 1.0ug/mlDCAF4 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com