Product Number |
ARP55298_P050 |
Product Page |
www.avivasysbio.com/wdr21a-antibody-middle-region-arp55298-p050.html |
Name |
WDR21A Antibody - middle region (ARP55298_P050) |
Protein Size (# AA) |
395 amino acids |
Molecular Weight |
43kDa |
NCBI Gene Id |
26094 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
DDB1 and CUL4 associated factor 4 |
Alias Symbols |
WDR21, WDR21A |
Peptide Sequence |
Synthetic peptide located within the following region: GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004) |
Description of Target |
WDR21A is a WD repeat-containing protein. The function of WDR21A remains unknown.This gene encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. |
Protein Interactions |
CUL4A; CUL4B; DDB1; SOX30; UBC; COPS5; COPS6; USP7; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DCAF4 (ARP55298_P050) antibody |
Blocking Peptide |
For anti-DCAF4 (ARP55298_P050) antibody is Catalog # AAP55298 (Previous Catalog # AAPP33129) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human WDR21A |
Uniprot ID |
Q8IV10 |
Protein Name |
DDB1- and CUL4-associated factor 4 Ensembl ENSP00000377781 |
Sample Type Confirmation |
DCAF4 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_851937 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_181340 |
Tested Species Reactivity |
Human |
Gene Symbol |
DCAF4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 100%; Rabbit: 93%; Rat: 86% |
Image 1 | Human Muscle
| WB Suggested Anti-WDR21A Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle |
|
Image 2 | Human Jurkat
| Host: Rabbit Target Name: DCAF4 Sample Type: Jurkat Antibody Dilution: 1.0ug/mlDCAF4 is supported by BioGPS gene expression data to be expressed in Jurkat |
|