COG4 Antibody - middle region (ARP55242_P050)

• Product Number: ARP55242_P050
• Name: COG4 Antibody - middle region (ARP55242_P050)
• Protein Size (# AA): 789 amino acids
• Molecular Weight: 89kDa
• Subunit: 4
• NCBI Gene Id: 25839
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Component of oligomeric golgi complex 4
• Alias Symbols: COD1, CDG2J, SWILS
• Peptide Sequence: Synthetic peptide located within the following region: LFSQGIGGEQAQAKFDSCLSDLAAVSNKFRDLLQEGLTELNSTAIKPQVQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718
• Description of Target: Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG4.Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG4 (Ungar et al., 2002 [PubMed 11980916]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-265 AK096557.1 1-265 266-555 BP282697.1 230-519 556-1072 AU125729.1 34-550 1073-2838 AL050101.1 375-2140
• Protein Interactions: UBC; EGFR; COG6; VCP; COG7; COG8; COG3; COG5; COG1; RPS20; CUL4B; SEPT2; APC; COG2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-COG4 (ARP55242_P050) antibody is Catalog # AAP55242 (Previous Catalog # AAPP33069)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human COG4
• Uniprot ID: Q9H9E3
• Protein Name: Conserved oligomeric Golgi complex subunit 4
• Sample Type Confirmation:

  COG4 is supported by BioGPS gene expression data to be expressed in 721_B

• Protein Accession #: NP_056201
• Purification: Affinity Purified
• Nucleotide Accession #: NM_015386
• Tested Species Reactivity: Human
• Gene Symbol: COG4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human, Mouse
  
  Sample Type: 1. Human Cervical Cancer Cell Lysate (15ug)
  2. Monkey Fibroblast Cell Lysate (15ug)
  3. Human Cervical Cancer Cell transfected with Myc-COG4 (15ug)
  Primary Dilution: 1:1000
  Secondary Antibody: goat anti-Rabbit
  Secondary Dilution: 1:40,000
  Image Submitted by:  Dr. Jakob Szwedo, Dr. Lupashin's Lab
  University of Arkansas for Medical SciencesSee Customer Feedback tab for detailed information.
  
  
• Image 2: Human 721_B
  
  WB Suggested Anti-COG4 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: 721_B cell lysateCOG4 is supported by BioGPS gene expression data to be expressed in 721_B