| Product Number |
ARP55188_P050 |
| Product Page |
www.avivasysbio.com/fam168a-antibody-n-terminal-region-arp55188-p050.html |
| Name |
Fam168a Antibody - N-terminal region (ARP55188_P050) |
| Protein Size (# AA) |
235 amino acids |
| Molecular Weight |
26kDa |
| NCBI Gene Id |
319604 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Family with sequence similarity 168, member A |
| Alias Symbols |
mKIAA0280, 2610030B18Rik, B930006L02Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: NSPSYAPATLLMKQAWPQNSSSCGTEGTFHLPVDTGTENRTYQASSAAFR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Fam168a (ARP55188_P050) antibody |
| Blocking Peptide |
For anti-Fam168a (ARP55188_P050) antibody is Catalog # AAP55188 (Previous Catalog # AAPP32993) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q68FE1 |
| Protein Name |
Family with sequence similarity 168, member A EMBL AAH79886.1 |
| Protein Accession # |
NP_848879 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_178764 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Fam168a |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Mouse Heart
 | WB Suggested Anti-Fam168a Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Heart |
|
|
