TMOD3 Antibody - middle region (ARP55078_P050)

Data Sheet
 
Product Number ARP55078_P050
Product Page www.avivasysbio.com/tmod3-antibody-middle-region-arp55078-p050.html
Name TMOD3 Antibody - middle region (ARP55078_P050)
Protein Size (# AA) 352 amino acids
Molecular Weight 39kDa
NCBI Gene Id 29766
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Tropomodulin 3 (ubiquitous)
Alias Symbols UTMOD
Peptide Sequence Synthetic peptide located within the following region: ITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Weber,K.L., J. Cell. Sci. 120 (PT 20), 3625-3632 (2007)
Description of Target TMOD3 belongs to the tropomodulin family. It blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton. This gene is a necessary element in receptor tyrosine kinase pathways, possibly as a tyrosine phosphorylation target. It is involved in regulation of RAF in the MAPK pathway and may also play a role in a MAPK-independent pathway.
Protein Interactions UBC; PABPC1; YWHAE; PSMD9; PPP1CA; DHX15; PAN2; CSNK2A1; HNRNPUL2; PPIL3; AHCYL1; SULT1A1; PSMC4; PSMB7; NPC1; ATP6V1B1; LRRK2; FBXO25; ISG15; ARRB2; ARRB1; ELAVL1; SUMO2; DUSP23; TNFSF11; MAP1LC3B; Poc1b; Tubgcp3; Sass6; Trim69; Stag2; Pafah1b1; Erh; Cdk
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TMOD3 (ARP55078_P050) antibody
Blocking Peptide For anti-TMOD3 (ARP55078_P050) antibody is Catalog # AAP55078 (Previous Catalog # AAPP32687)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TMOD3
Uniprot ID Q9NYL9
Protein Name Tropomodulin-3
Protein Accession # NP_055362
Purification Affinity Purified
Nucleotide Accession # NM_014547
Tested Species Reactivity Human
Gene Symbol TMOD3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human HepG2
WB Suggested Anti-TMOD3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com