Product Number |
ARP55078_P050 |
Product Page |
www.avivasysbio.com/tmod3-antibody-middle-region-arp55078-p050.html |
Name |
TMOD3 Antibody - middle region (ARP55078_P050) |
Protein Size (# AA) |
352 amino acids |
Molecular Weight |
39kDa |
NCBI Gene Id |
29766 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Tropomodulin 3 (ubiquitous) |
Alias Symbols |
UTMOD |
Peptide Sequence |
Synthetic peptide located within the following region: ITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Weber,K.L., J. Cell. Sci. 120 (PT 20), 3625-3632 (2007) |
Description of Target |
TMOD3 belongs to the tropomodulin family. It blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton. This gene is a necessary element in receptor tyrosine kinase pathways, possibly as a tyrosine phosphorylation target. It is involved in regulation of RAF in the MAPK pathway and may also play a role in a MAPK-independent pathway. |
Protein Interactions |
UBC; PABPC1; YWHAE; PSMD9; PPP1CA; DHX15; PAN2; CSNK2A1; HNRNPUL2; PPIL3; AHCYL1; SULT1A1; PSMC4; PSMB7; NPC1; ATP6V1B1; LRRK2; FBXO25; ISG15; ARRB2; ARRB1; ELAVL1; SUMO2; DUSP23; TNFSF11; MAP1LC3B; Poc1b; Tubgcp3; Sass6; Trim69; Stag2; Pafah1b1; Erh; Cdk |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TMOD3 (ARP55078_P050) antibody |
Blocking Peptide |
For anti-TMOD3 (ARP55078_P050) antibody is Catalog # AAP55078 (Previous Catalog # AAPP32687) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TMOD3 |
Uniprot ID |
Q9NYL9 |
Protein Name |
Tropomodulin-3 |
Protein Accession # |
NP_055362 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_014547 |
Tested Species Reactivity |
Human |
Gene Symbol |
TMOD3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Image 1 | Human HepG2
| WB Suggested Anti-TMOD3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
|