| Product Number |
ARP55052_P050 |
| Product Page |
www.avivasysbio.com/cpne7-antibody-c-terminal-region-arp55052-p050.html |
| Name |
Cpne7 Antibody - C-terminal region (ARP55052_P050) |
| Protein Size (# AA) |
486 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
361433 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Copine VII |
| Alias Symbols |
Cpne7 |
| Peptide Sequence |
Synthetic peptide located within the following region: GDDGILRSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of Cpne7 remains unknow. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Cpne7 (ARP55052_P050) antibody |
| Blocking Peptide |
For anti-Cpne7 (ARP55052_P050) antibody is Catalog # AAP55052 (Previous Catalog # AAPP32661) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Uniprot ID |
D3ZWR4 |
| Protein Name |
Copine VII (Predicted), isoform CRA_b EMBL EDL92784.1 |
| Protein Accession # |
NP_001101924 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001108454 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Cpne7 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 93%; Zebrafish: 92% |
| Image 1 | Rat Brain
 | WB Suggested Anti-Cpne7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Rat Brain |
|
|
